HORDB

General Information

ID: hor005893
Uniprot ID: Q9PW56
Protein name: Bradykinin-potentiating peptide 10c
Gene name: NA
Organism: Bothrops jararaca (Jararaca) (Bothrops jajaraca)
Family: Bradykinin-potentiating peptide family; PHpG family; Natriuretic peptide family
Source: Animal
Expression: BPP-10a, BPP-10c+QQWA, BPP-AP, BPP-13A, BPP-13a+QWA and BPP-13a+QQWA seem to be found in both adult and newborn B.jararaca venoms, whereas BPP-APL seem to be only present in newborn venom. |Adult brain regions; ventromedial hypothalamus, paraventricular n
Disease: NA
Comments: NA
Taxonomy: Bothrops (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0060422 peptidyl-dipeptidase inhibitor activity; GO:0090729 toxin activity
GO BP: GO:0006469 negative regulation of protein kinase activity; GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0045776 negative regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005575 cellular_component; GO:0005576 extracellular region; GO:0005737 cytoplasm; GO:0005829 cytosol

Sequence Information

Sequence: QNWPHPQIPP
Length: 10(71-80)
Propeptide: MVLSRLAASGLLLLALLALSVDGKPVQQWAQGGWPRPGPEIPPLKVQQWAQGGWPRPGPEIPPLTVQQWAQNWPHPQIPPLTVQQWAQWGRPPGPPIPPLTVQQWAQARPPHPPIPPAPLQKWAPVQKWAPLLQPHESPASGTTALREELSLGPEAASGVPSAGAEVGRSGSKAPAAPHRLSKSKGAAATSAASRPMRDLRPDGKQARQNWGRMVHHDHHAAVGGGGGGGGGGARRLKGLAKKGAAKGCFGLKVD
Signal peptide: MVLSRLAASGLLLLALLALSVDG
Modification: T1 Pyrrolidone carboxylic acid
Glycosylation: NA
Mutagenesis: 4-4P->A: Low decrease in ability to enhance AsS activity.; 6-6P->A: Low decrease in ability to enhance AsS activity.; 8-8P->A: Low decrease in ability to enhance AsS activity.; 9-9P->A: Low decrease in ability to enhance AsS activity.; 10-10P->A: Low decr

Activity

Function: [Bradykinin-potentiating peptide 5a]: Modestly inhibits ACE (with highest affinity for the N-site) and reveals strong bradykinin-potentiating activity. Induces nitric oxide (NO) production depended on muscarinic acetylcholine receptor M1 subtype (CHRM1) a
Mechanism: The name evasin stands for 'Endogenous VASopeptidase INhibitors' and is given to endogenous brain proteins in order to distinguish them from venom proteins.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9PW56-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005893_AF2.pdb

hor005893_ESM.pdb

Physical Information

Mass:	137407	Formula:	C57H80N16O14
Absent amino acids:	ACDEFGKLMRSTVY	Common amino acids:	P
pI:	7.55	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	2
Hydrophobicity:	-165	Boman Index:	-1513
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	39
Instability Index:	3139	Extinction Coefficient cystines:	5500
Absorbance 280nm:	611.11

Literature

PubMed ID: 12716428
Title: The C-type natriuretic peptide precursor of snake brain contains highly specific inhibitors of the angiotensin-converting enzyme.
PubMed ID: 22869554
Title: Peptidomics of three Bothrops snake venoms: insights into the molecular diversification of proteomes and peptidomes.
PubMed ID: 20146532
Title: Analys
PubMed ID: 15245866
Title:
PubMed ID: 11994001
Title:
PubMed ID: 17475904
Title:
PubMed ID: 19491403
Title:
PubMed ID: 21185808
Title:
PubMed ID: 15922781
Title: